PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV46474.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ARF
Protein Properties Length: 767aa    MW: 85931 Da    PI: 6.7307
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV46474.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3551.5e-1774169198
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 f+k+lt sd++++g +++ +++a+e+       ++++  ++l+ +d++g +W++++i+r++++r++l++GW+ Fv +++L +gD         +++el+
  KZV46474.1  74 FCKILTASDTSTHGGFSVLRRHADEClppldmTKQPPI-QELVAKDLHGIEWRFRHIFRGQPRRHLLQSGWSMFVGSKRLIAGDA-------GENGELR 164
                 99****************************98555555.49*******************************************6.......2555566 PP

                 EEEE- CS
          B3  94 vkvfr 98 
                 v+v+r
  KZV46474.1 165 VGVRR 169
                 66655 PP

2Auxin_resp115.93.5e-38195277183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++tk++F+v+Y+Pr+s++eF+v+++++++++k+++s+G Rfkm+fe+++++e+r++Gt+vg++d+d+ rWpnSkWr+Lk
  KZV46474.1 195 AWHATQTKTMFTVYYKPRTSPAEFIVPYDQYVNSVKNNYSAGLRFKMRFEGDEAPEQRFTGTIVGIEDSDSKRWPNSKWRCLK 277
                 79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.79E-3370198IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-3171184IPR015300DNA-binding pseudobarrel domain
CDDcd100175.23E-1772169No hitNo description
PfamPF023621.7E-1574157IPR003340B3 DNA binding domain
SMARTSM010191.9E-1474171IPR003340B3 DNA binding domain
PfamPF065072.2E-35195277IPR010525Auxin response factor
PfamPF023096.5E-9636731IPR033389AUX/IAA domain
PROSITE profilePS5174524.928640733IPR000270PB1 domain
SuperFamilySSF542772.42E-9640717No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
VEASTKQSED LQIPVYNLPP KILCRVVNVN LKAEPDTDEV FAQIILIPEP NQDENARKKE  60
TLPPPPPRFH VHSFCKILTA SDTSTHGGFS VLRRHADECL PPLDMTKQPP IQELVAKDLH  120
GIEWRFRHIF RGQPRRHLLQ SGWSMFVGSK RLIAGDAGEN GELRVGVRRA MKQQGNAPSS  180
VISSHNMHLG VLATAWHATQ TKTMFTVYYK PRTSPAEFIV PYDQYVNSVK NNYSAGLRFK  240
MRFEGDEAPE QRFTGTIVGI EDSDSKRWPN SKWRCLKVRW DEISAVPRPD RVSPWNIEPV  300
PPHAMNPLPV ARSKRPRPSA LPSSPDSPGL TRKGTPKMTV DPRPASGIPK VLQGQEISNS  360
RGTFLERNDS NMSENRLSWG PPLDEEKIDD VSTSRKYESD NWLSSGRTEM LFTDLLSGLE  420
SQIDSSDGFC MSSGEANLKH ITREQAAKFT LVGNAWSMVP SDMPLDVMDS GSKTRMQSCH  480
TSHQPHSEVR YDTLKGFSTS PCPMSDNQQA NWLMPPPTSP YVQILPDESQ NLMPKSICKQ  540
MPESLKSKEG NFKLFGIPLI SNSVPLKPAS LNTTMEPSGH ALEDINSYYS STTESDQRFD  600
KSKGSKPIFP AAVCESEKHF QTFHPVARER EDKVCSVSTR SCTKVHKQGM ALGRSIELAK  660
FNNYDELIAE LDNLFVFDGE LKARSKNWLV AYTDDEDDMM LVGDDPWEEF CGMAREILIL  720
TNEEVLRMNP RNFGVKGENT SSIAEGSDSK EAKYLQTTSS SNMAPAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-136130052355Auxin response factor 1
4ldw_A1e-136130052355Auxin response factor 1
4ldv_A1e-136130052355Auxin response factor 1
4ldx_B1e-136130052355Auxin response factor 1
4ldx_A1e-136130052355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1313317KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073189.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A022Q1X60.0A0A022Q1X6_ERYGU; Auxin response factor
STRINGSolyc03g118290.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2